PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G1088
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 985aa    MW: 109028 Da    PI: 6.4291
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G1088genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.21.8e-41154231178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqve+C adl++ak+yhrrhkvCe+hska+++lv +++qrfCqqCsrfh l+efD++krsCrrrLa+hn+rrrk+++
  Gh_D11G1088 154 VCQVEDCGADLTNAKDYHRRHKVCEMHSKASKALVGNVMQRFCQQCSRFHVLQEFDDGKRSCRRRLAGHNKRRRKTNP 231
                  6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.6E-34148216IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.129152229IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-38153234IPR004333Transcription factor, SBP-box
PfamPF031107.3E-30155228IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.202.6E-5727872IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484033.73E-6756870IPR020683Ankyrin repeat-containing domain
CDDcd002041.10E-5758869No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 985 aa     Download sequence    Send to blast
MEARFGSEAH HFYGMSPADL RAVGKRTVEW DLNDWKWDGD LFIASSINPM SADTMGRQFF  60
PLGSGIPGNS SNSSSSCSDE LNLKAQKGKR ELGKKRRVTV VEDDSLNEET GSLTLKLGGQ  120
GDHGYPISQG EMKNWEGTSG KKTKLNGGSG NRAVCQVEDC GADLTNAKDY HRRHKVCEMH  180
SKASKALVGN VMQRFCQQCS RFHVLQEFDD GKRSCRRRLA GHNKRRRKTN PATVVNGNSL  240
NDEQTSGYLL LSLLKILSNM HSNRSDQTTD QDVLPQLLQS LANHTDEQGG RNISGLLPEP  300
KGSEAGSALF LNGEGPSRPF RQHITEAASE MPQKGVHSHD ARVTNVQGNA AGSVKMNNFD  360
LNDTYIDSDD GADDIEGFPA PLNMGTSSLD CPSWVQQDSH QSSPPQTSGN SDSVSAQSPS  420
SSSGDTQSRT DRIVFKLFGK EPNDFPLLLR AQILDWLSHS PTDIESYIRP GCIVLTIYLC  480
QSKAAWDELC CDLSFSLNRL LDCSDDTFWR TGWICTRVQD QIAFIYKGQV VVDTSLPLGS  540
NHSSKIMSVK PIALCATERA KFSVKGVNLS QPATRLLCAV EGKYLVQEAT HELMDSHDEF  600
KAQDELQYLN FSCSIPTVTG RGFIEIEDDG YNSSFFPFIV AEDDVCSEIR MLESLLEITD  660
AEAAVDRTGK MEAKNQAMDF IHEVGWLLHR SQLKSRLGHL DPNSEPFSLR RFKWLMEFSM  720
DHEWCAVVKK LLNVLLDGVV GSGEHPSLNL ALTEMGLLHR AVRKNCRPLV ELFLRFIPEK  780
GSSRLGLENE MVAGGIHESF LFRPDALGPS GLTPLHIAAG KDDSEDVLDA LTDDPGKVGI  840
GAWKSARDST GSTPEDYARL RGHYSYIHLV QKKINKRHSE HVVVDVPGPL SDCSTNRKQN  900
NESTSSFEIG QLELRSMKRH CKLCDQKLAY GYGTASRSLA YRPAMLSMVA IAAVCVCVAL  960
LFKSCPEVLY VFRPFRWELL DYGTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-31146228384squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.211090.0boll| ovule
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223250.0KJ622325.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL17) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490238.10.0PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A0D2P7I50.0A0A0D2P7I5_G
STRINGPOPTR_0002s18970.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30302764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1